Sequence 1: | NP_001163602.1 | Gene: | Hrb87F / 48535 | FlyBaseID: | FBgn0004237 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001369851.1 | Gene: | msi-1 / 175514 | WormBaseID: | WBGene00003423 | Length: | 320 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 70/196 - (35%) |
---|---|---|---|
Similarity: | 114/196 - (58%) | Gaps: | 13/196 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 AEQND-SNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSR 65
Fly 66 GFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEEC 130
Fly 131 LREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195
Fly 196 M 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hrb87F | NP_001163602.1 | RRM1_hnRNPA_like | 25..102 | CDD:241022 | 34/76 (45%) |
RRM_SF | 116..188 | CDD:302621 | 23/71 (32%) | ||
msi-1 | NP_001369851.1 | RRM1_MSI | 46..121 | CDD:409990 | 33/74 (45%) |
RRM2_MSI | 135..208 | CDD:240769 | 23/72 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |