DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and msi-1

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001369851.1 Gene:msi-1 / 175514 WormBaseID:WBGene00003423 Length:320 Species:Caenorhabditis elegans


Alignment Length:196 Identity:70/196 - (35%)
Similarity:114/196 - (58%) Gaps:13/196 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEQND-SNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSR 65
            |:.:| |:|:.|.|          |:|||||.::||.:.|:.:|.::|.:.:.:||:||.|||:|
 Worm    32 ADSDDGSHGSQDPG----------KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRAR 86

  Fly    66 GFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEEC 130
            ||||||:.....:|...|.|.|::||:.::||.|.|::  .........||:|:|||......|.
 Worm    87 GFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKR--TQAKLVTKTKKVFIGGLSATSTLED 149

  Fly   131 LREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195
            :::||:.:|::....::.||.|.:.|||.|:.||..:..||:.....|.|..|.::.|||..|:.
 Worm   150 MKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEV 214

  Fly   196 M 196
            |
 Worm   215 M 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 34/76 (45%)
RRM_SF 116..188 CDD:302621 23/71 (32%)
msi-1NP_001369851.1 RRM1_MSI 46..121 CDD:409990 33/74 (45%)
RRM2_MSI 135..208 CDD:240769 23/72 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.