DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and pabp-2

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_492504.1 Gene:pabp-2 / 172768 WormBaseID:WBGene00003904 Length:205 Species:Caenorhabditis elegans


Alignment Length:154 Identity:32/154 - (20%)
Similarity:62/154 - (40%) Gaps:38/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEQNDSNGNY--------DDGEEITEPEQ-----LRKLFIGGLDYRTTDDGLKAHFEKWGNIVDV 53
            |.||:..|:.        :..:.:..||:     .:.:::|.:||..|.:.::.||...|::..|
 Worm    43 AIQNEMVGHMNLNTSSQSNSSQSLLTPEEKAEADAKSVYVGNVDYGATAEEIEQHFHGCGSVSRV 107

  Fly    54 VVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGR--TVEPKRAVPRQEIDSPNAGAT--- 113
            .:..|..:...:||.::.:::...:.||.......:.||  .|:|||.      :.|....|   
 Worm   108 TIQCDRFSGHPKGFAYVEFTEKEGMQNALAMTDSLLRGRQIKVDPKRT------NKPGMSTTNRP 166

  Fly   114 --------------VKKLFVGGLR 123
                          ||.::.||.|
 Worm   167 PFRGRGGRGRGNVIVKYVYAGGFR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 19/78 (24%)
RRM_SF 116..188 CDD:302621 3/8 (38%)
pabp-2NP_492504.1 RRM_SF 79..154 CDD:388407 17/74 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.