DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and RBMY1F

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_689798.1 Gene:RBMY1F / 159163 HGNCID:23974 Length:496 Species:Homo sapiens


Alignment Length:322 Identity:78/322 - (24%)
Similarity:110/322 - (34%) Gaps:105/322 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 EIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDP 168
            |.|.|.      |||:|||..:.:|:.|:..|...|.|..|.::.|: |.|.||||||.|:  :|
Human     3 EADHPG------KLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDR-TSKSRGFAFITFE--NP 58

  Fly   169 VDKIILQKTHSIKNKTLDVK------KAIAKQDMDRQG-GGGGRGGPRAGGRGGQGDRGQGGGGW 226
            .|         .||...|:.      |||..:...:.. ..|||..|.|..|             
Human    59 AD---------AKNAAKDMNGTSLHGKAIKVEQAKKPSFQSGGRRRPPASSR------------- 101

  Fly   227 GGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGW--NQQG--GSGG-------------- 273
               ||...|..               ....|..||:.||  :.:|  ..||              
Human   102 ---NRSPSGSL---------------RSARGSSGGTRGWLPSHEGHLDDGGYTPDLKMSYSRGLI 148

  Fly   274 ----GPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRN--S 332
                ||.:..||.....:...    ....|| ||.|:.|.       .::.:::||..|:|.  |
Human   149 PVKRGPSSRSGGPPPKKSAPS----AVARSN-SWMGSQGP-------MSQRRENYGVPPRRATIS 201

  Fly   333 NFGNNRPAPYSQGGGGGGFNKGNQGGGQ----------GFAGNNYNTGGGGQGGNMGGGNRR 384
            ::.|:|   .|....|...|.||....|          |:|..:.......:..:.|..|.|
Human   202 SWRNDR---MSTRHDGYATNDGNHPSCQETRDYAPPSRGYAYRDNGHSNRDEHSSRGYRNHR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022
RRM_SF 116..188 CDD:302621 27/71 (38%)
RBMY1FNP_689798.1 RRM <1..189 CDD:223796 60/246 (24%)
RRM_RBMX_like 7..85 CDD:240828 31/95 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..345 45/226 (20%)
dnaA 158..>316 CDD:333091 26/118 (22%)
RBM1CTR 174..218 CDD:311845 15/54 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 452..496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.