Sequence 1: | NP_001163602.1 | Gene: | Hrb87F / 48535 | FlyBaseID: | FBgn0004237 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036019590.1 | Gene: | Elavl2 / 15569 | MGIID: | 1100887 | Length: | 530 | Species: | Mus musculus |
Alignment Length: | 239 | Identity: | 51/239 - (21%) |
---|---|---|---|
Similarity: | 77/239 - (32%) | Gaps: | 93/239 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITY------------------ 72
Fly 73 ------------------------------------------SQSYMIDNAQNA--------RPH 87
Fly 88 KIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDT 152
Fly 153 GKKRGFAFIEFDDYDPV-------------DKII-----LQKTH 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hrb87F | NP_001163602.1 | RRM1_hnRNPA_like | 25..102 | CDD:241022 | 25/143 (17%) |
RRM_SF | 116..188 | CDD:302621 | 23/81 (28%) | ||
Elavl2 | XP_036019590.1 | ELAV_HUD_SF | 206..529 | CDD:273741 | 51/239 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |