Sequence 1: | NP_001163602.1 | Gene: | Hrb87F / 48535 | FlyBaseID: | FBgn0004237 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016858809.1 | Gene: | RBM45 / 129831 | HGNCID: | 24468 | Length: | 617 | Species: | Homo sapiens |
Alignment Length: | 310 | Identity: | 52/310 - (16%) |
---|---|---|---|
Similarity: | 88/310 - (28%) | Gaps: | 150/310 - (48%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 AEQNDSNGNYDDG-EEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSR 65
Fly 66 GFGFITYSQSYMIDNA-----------QNARPHKI--------------------------DGRT 93
Fly 94 VEPKRA------------------------------------VPRQEIDSPN--------AG--- 111
Fly 112 ------------------------------------------ATVKKLFV------GGLRDDHDE 128
Fly 129 EC---------------LREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEF 163 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hrb87F | NP_001163602.1 | RRM1_hnRNPA_like | 25..102 | CDD:241022 | 20/149 (13%) |
RRM_SF | 116..188 | CDD:302621 | 19/69 (28%) | ||
RBM45 | XP_016858809.1 | RRM1_RBM45 | 23..101 | CDD:409801 | 18/79 (23%) |
PABP-1234 | <41..206 | CDD:130689 | 24/164 (15%) | ||
RRM2_RBM45 | 263..336 | CDD:409802 | 12/49 (24%) | ||
RRM3_RBM45 | 389..461 | CDD:409803 | |||
RRM4_RBM45 | 534..601 | CDD:409804 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |