DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and RBM45

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_016858809.1 Gene:RBM45 / 129831 HGNCID:24468 Length:617 Species:Homo sapiens


Alignment Length:310 Identity:52/310 - (16%)
Similarity:88/310 - (28%) Gaps:150/310 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEQNDSNGNYDDG-EEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSR 65
            |..:.|.|.:..| :.:.||...|...:  :...|.:..|:..|..:|:|.|:.|::|..||.|:
Human     4 AGSSASGGGFRPGVDSLDEPPNSRIFLV--ISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESK 66

  Fly    66 GFGFITYSQSYMIDNA-----------QNARPHKI--------------------------DGRT 93
            |..|:.:::|.....|           .:.:|.|:                          :|..
Human    67 GIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVRVPGSGCPRGKEWASWTSLHLLLCRGEGGV 131

  Fly    94 VEPKRA------------------------------------VPRQEIDSPN--------AG--- 111
            ..|..|                                    .||:....|.        ||   
Human   132 EHPFPAADQTAPGLGTGAALRRGSPPTKLRRVAGKGTGCGVFAPRERTRQPRPPGDRTAVAGLPL 196

  Fly   112 ------------------------------------------ATVKKLFV------GGLRDDHDE 128
                                                      :|..::|:      |..||..||
Human   197 SLALTNPPALEFTAKLVLAYFEYFSDLPLSDAQISIYKKRKNSTFPQVFIAQSRSSGSHRDVEDE 261

  Fly   129 EC---------------LREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEF 163
            |.               |||.||.:|.|...:|:.:|.||:.:|..::.:
Human   262 ELTRIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 20/149 (13%)
RRM_SF 116..188 CDD:302621 19/69 (28%)
RBM45XP_016858809.1 RRM1_RBM45 23..101 CDD:409801 18/79 (23%)
PABP-1234 <41..206 CDD:130689 24/164 (15%)
RRM2_RBM45 263..336 CDD:409802 12/49 (24%)
RRM3_RBM45 389..461 CDD:409803
RRM4_RBM45 534..601 CDD:409804
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.