DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AgaP_AGAP009952

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_319085.4 Gene:AgaP_AGAP009952 / 1279370 VectorBaseID:AGAP009952 Length:363 Species:Anopheles gambiae


Alignment Length:219 Identity:50/219 - (22%)
Similarity:82/219 - (37%) Gaps:59/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNA--------- 81
            |::.||........|:|.|..:|.|:...::.|..|..|:|.|||.:.|....:.|         
Mosquito   137 LYVSGLPKNMLQADLEALFSPYGRIITSRILCDNITGLSKGVGFIRFDQRMEAEKAIKELNGTVP 201

  Fly    82 -QNARPHKI-------DGRTVEP----------KR-------------AVPRQEIDSPNAGATVK 115
             .:..|..:       ..:||.|          :|             |:|.... ||.||..:.
Mosquito   202 KGSTEPITVKFANNPSSTKTVPPLAAYLGPQAARRFPGPIHHPTGRFSAIPNYRY-SPLAGDLLA 265

  Fly   116 K---------------LFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDD 165
            .               :||..|..:.:|..|.:.|..||.:.||.::.|..|.|.:||.|:...:
Mosquito   266 NSMIPTNAIANGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIKDLQTNKCKGFGFVTMTN 330

  Fly   166 YDPVDKIILQKT--HSIKNKTLDV 187
            ||.. .:.:|..  :::.|:.|.|
Mosquito   331 YDEA-VVAIQSLNGYTLGNRVLQV 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 23/115 (20%)
RRM_SF 116..188 CDD:302621 22/89 (25%)
AgaP_AGAP009952XP_319085.4 ELAV_HUD_SF 24..361 CDD:273741 50/219 (23%)
RRM1_Hu 26..125 CDD:241094
RRM2_Hu 135..213 CDD:241096 18/75 (24%)
RRM3_Hu 279..356 CDD:240823 22/76 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.