DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AgaP_AGAP002335

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_312633.5 Gene:AgaP_AGAP002335 / 1273632 VectorBaseID:AGAP002335 Length:458 Species:Anopheles gambiae


Alignment Length:233 Identity:61/233 - (26%)
Similarity:90/233 - (38%) Gaps:67/233 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMK----DPKTKRSRGFGFITYSQSYM 77
            :||....:.|::|.||...|::.|...|.:.|.:....:::    ||       |.||.|:    
Mosquito     1 MTEESYPKTLYVGNLDTSVTEELLCTLFSQMGTVKSCKIIRETSIDP-------FAFIEYA---- 54

  Fly    78 IDNAQNARPHKIDGRTVEPKRAVPRQEID---SPNAGATVK-------KLFVGGLRDDHDEECLR 132
              |.|:|:    .......||...::||.   :.:||...|       .:|||.|..:.|.|.||
Mosquito    55 --NHQSAQ----TALAAMNKRMFLKKEIRVNWATSAGNQPKTDTSQHHHIFVGDLSPEIDTETLR 113

  Fly   133 EYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197
            |.|..||:|.:..||.|..|.|.||:||:.|                       ||||.|:..:.
Mosquito   114 EAFAPFGEISNCRIVRDPQTLKSRGYAFVSF-----------------------VKKAEAENAIA 155

  Fly   198 RQGGG--GGRG-----------GPRAGGRGGQGDRGQG 222
            ...|.  |.|.           .||...:|.:..:..|
Mosquito   156 MMNGQWLGSRSIRTNWSTRKPPAPRENSKGIKSGKTPG 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 19/80 (24%)
RRM_SF 116..188 CDD:302621 23/71 (32%)
AgaP_AGAP002335XP_312633.5 RRM1_TIA1_like 10..81 CDD:240798 21/87 (24%)
RRM2_TIA1_like 97..171 CDD:240799 31/96 (32%)
RRM3_TIA1_like 206..279 CDD:240800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.