DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AgaP_AGAP002256

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_307927.5 Gene:AgaP_AGAP002256 / 1269305 VectorBaseID:AGAP002256 Length:255 Species:Anopheles gambiae


Alignment Length:105 Identity:27/105 - (25%)
Similarity:50/105 - (47%) Gaps:9/105 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNAR 85
            |..|.|:.|.|..|.|::.|...|.:.|.:.:|.:.:| ..:|.|.:.|||::....::.|.:. 
Mosquito     3 EDDRTLWCGNLSERVTEEMLYELFLQAGPVENVKIPRD-ADRRQRNYAFITFAHVCSVEYAMDI- 65

  Fly    86 PHKIDGRTV-EPKRAVPRQEIDSPNAGATVKKLF---VGG 121
               .:|.|: :....:.|:..:.||..|:.:..|   .||
Mosquito    66 ---FEGTTLFQRTLTLHRKNRNGPNPAASPQVNFNYPAGG 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 18/77 (23%)
RRM_SF 116..188 CDD:302621 3/9 (33%)
AgaP_AGAP002256XP_307927.5 RRM <2..>123 CDD:223796 27/105 (26%)
RRM_RBM7_like 5..78 CDD:240782 19/77 (25%)
DUF755 <187..242 CDD:253225
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.