DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AgaP_AGAP012503

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_307184.4 Gene:AgaP_AGAP012503 / 1268621 VectorBaseID:AGAP012503 Length:417 Species:Anopheles gambiae


Alignment Length:217 Identity:49/217 - (22%)
Similarity:100/217 - (46%) Gaps:37/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QNDSNGNYDDGEEITEPEQLRKLFI--GGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRG 66
            ::::..:.:..:||:|...:.:||:  |   .:.|.:.|..|||..|.|.:.||:.|.||.:.:|
Mosquito     5 RDNTMSDVNRAKEISEEPPMSRLFVICG---KQITKEQLIKHFEPDGTIEECVVITDRKTGQGKG 66

  Fly    67 FGFITYSQSYMIDNAQNARPHKIDGRTVE----PKRAVPRQEID---SPNAGATVK-----KLFV 119
            ..::.::::     :..||..:.:|..||    |.:.:.....:   :.:..|.|.     :|| 
Mosquito    67 VAYVKFTKT-----SSAARGLRKNGTVVEGDTRPIKVMISASYNRDKNSDTSADVNENQFLRLF- 125

  Fly   120 GGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKN-- 182
            ..:..:..||.|:|.|...|.:..|.:|.||...|:.. |:|:|..:       |:...:|:|  
Mosquito   126 AIVPSNRTEEQLKEEFGTHGTVTQVRLVPDKKNDKQCA-AYIKFPTF-------LETALAIENCN 182

  Fly   183 ----KTLDVKKAIAKQDMDRQG 200
                ....|.::..:|:.:::|
Mosquito   183 PQYKAKFCVPRSKLQQEREQKG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 22/82 (27%)
RRM_SF 116..188 CDD:302621 19/77 (25%)
AgaP_AGAP012503XP_307184.4 RRM_SF 22..100 CDD:302621 22/85 (26%)
RRM_SF 122..193 CDD:302621 20/79 (25%)
RRM_SF 229..300 CDD:302621
RRM_SF 336..401 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.