DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Hrb87F and RBM7

DIOPT Version :9

Sequence 1:	NP_001163602.1	Gene:	Hrb87F / 48535	FlyBaseID:	FBgn0004237	Length:	385	Species:	Drosophila melanogaster
Sequence 2:	NP_001272974.1	Gene:	RBM7 / 10179	HGNCID:	9904	Length:	267	Species:	Homo sapiens

Alignment Length:	49	Identity:	22/49 - (44%)
Similarity:	27/49 - (55%)	Gaps:	1/49 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   115 KKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEF 163
            :.||||.|.....||.|.|.|...|.::.|.|..||| ||.:.|||:.|
Human    10 RTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKD-GKPKQFAFVNF 57

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Hrb87F	NP_001163602.1	RRM1_hnRNPA_like	25..102	CDD:241022
Hrb87F	NP_001163602.1	RRM_SF	116..188	CDD:302621	22/48 (46%)
RBM7	NP_001272974.1	RRM	<9..>84	CDD:223796	22/49 (45%)
		RRM_RBM7	9..83	CDD:241036	22/49 (45%)
		ZCCHC8 binding. /evidence=ECO:0000269\|PubMed:27905398, ECO:0007744\|PDB:5LXR, ECO:0007744\|PDB:5LXY	25..35		3/9 (33%)
		ZCCHC8 binding. /evidence=ECO:0000269\|PubMed:27905398, ECO:0007744\|PDB:5LXR, ECO:0007744\|PDB:5LXY	59..76
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	163..267
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910