Sequence 1: | NP_001163602.1 | Gene: | Hrb87F / 48535 | FlyBaseID: | FBgn0004237 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012815941.1 | Gene: | elavl4 / 100125165 | XenbaseID: | XB-GENE-948210 | Length: | 430 | Species: | Xenopus tropicalis |
Alignment Length: | 238 | Identity: | 50/238 - (21%) |
---|---|---|---|
Similarity: | 77/238 - (32%) | Gaps: | 92/238 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITY------------------ 72
Fly 73 ------------------------------------------SQSYMIDNAQNA-------RPHK 88
Fly 89 IDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTG 153
Fly 154 KKRGFAFIEFDDYDPV-------------DKII-----LQKTH 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hrb87F | NP_001163602.1 | RRM1_hnRNPA_like | 25..102 | CDD:241022 | 25/142 (18%) |
RRM_SF | 116..188 | CDD:302621 | 23/81 (28%) | ||
elavl4 | XP_012815941.1 | ELAV_HUD_SF | 78..429 | CDD:273741 | 50/238 (21%) |
RRM1_Hu | 80..186 | CDD:241094 | |||
RRM_SF | 191..280 | CDD:302621 | 16/81 (20%) | ||
RRM3_HuD | 344..429 | CDD:241100 | 24/85 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |