DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and Gm3376

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001257441.1 Gene:Gm3376 / 100041505 MGIID:3781554 Length:380 Species:Mus musculus


Alignment Length:336 Identity:76/336 - (22%)
Similarity:115/336 - (34%) Gaps:102/336 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 EIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDP 168
            |.|.|.      |:|:|||.....::.|:|.|..||.:..|.::.|::|.|.|||||:.|  ..|
Mouse     3 ETDQPG------KIFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAFLTF--RRP 59

  Fly   169 VD-KIILQKTHSI--KNKTLDVKKAIAKQDMDRQGGGGGRGGPRAGGRGGQGDRGQG---GGGWG 227
            .| |..:::.:.:  ..|.:.||:|.....::    .|.:..|.:..|    .||..   ..|.|
Mouse    60 ADAKNAVKEMNGVILDGKRIKVKQARRPSSLE----SGSKKRPPSFSR----TRGASRILKCGRG 116

  Fly   228 GQNRQNGG----GNWGGAGGGGGF--GNSGGNFGGGQGGGSGGWNQQGGSGGGP-----WNNQGG 281
            |::|...|    ||.||......|  .:||.:|...:       |......|.|     .:.|..
Mouse   117 GRSRARSGPSCEGNLGGDRYTPNFNVSSSGRHFAVKR-------NPSSKRDGPPSKRSATSAQTR 174

  Fly   282 GNGGWNG--------------GGGGG-----------YGGGNSNGSWGGNGGG------------ 309
            .|.|..|              |....           ||..:::..:.....|            
Mouse   175 SNTGLRGREPHRREISRNMPRGEPASSRRDEYPLPRDYGQSSNDRKYESTSRGYCDYGNYHSREE 239

  Fly   310 -------------GGGGGGF-----GNEYQQSYGGGPQRNSNFGNNRPAPYSQGGGGGGFNKGNQ 356
                         ||....|     ||.|:.:|       .::|....||.::||.....:..|.
Mouse   240 SASKVFSDHAGYLGGRDRDFSEYLSGNSYRDTY-------RSYGRFHEAPSARGGNNRYDDYSNS 297

  Fly   357 GGGQGFAGNNY 367
            ..|.|..|..|
Mouse   298 QDGYGGRGEPY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022
RRM_SF 116..188 CDD:302621 24/74 (32%)
Gm3376NP_001257441.1 RRM <3..>85 CDD:223796 29/89 (33%)
RRM_SF 7..86 CDD:302621 28/86 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..226 30/158 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..358 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.