DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and PPH21

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_010147.1 Gene:PPH21 / 851421 SGDID:S000002292 Length:369 Species:Saccharomyces cerevisiae


Alignment Length:305 Identity:125/305 - (40%)
Similarity:181/305 - (59%) Gaps:19/305 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HEIDCIIKELTSLNGSEC-TLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLR 70
            :::|..|:.|     |:| .|.|:.:.||.:...:|::::..:..:..||.||||:||||.|||.
Yeast    68 NQLDQWIEHL-----SKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLE 127

  Fly    71 IFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYDE 135
            :||..|..|..||||:|||||||..|:||:..|.|.||:||....:|||||||..|.::||||||
Yeast   128 LFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDE 192

  Fly   136 IKRRH-TVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCD 199
            ..|:: :..:|..|||.|::.|:.|||..:|||.||||||.:..:.|:..:.|..::|.||.|||
Yeast   193 CLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCD 257

  Fly   200 LLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFS 264
            |||:|.: ...|||.:.||..|||.:.:...|....||.|:.|||::|.:||.:...:.:||:||
Yeast   258 LLWSDPD-DRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFS 321

  Fly   265 APNYCGMMNNAGGVMSVSTDLICSFVIILPCHKYKMIATDANQMP 309
            |||||....|...:|.|..:           |..:.:..|.:..|
Yeast   322 APNYCYRCGNQAAIMEVDEN-----------HNRQFLQYDPSVRP 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 125/304 (41%)
MPP_PP1_PPKL 8..294 CDD:277359 122/287 (43%)
PPH21NP_010147.1 MPP_PP2A_PP4_PP6 70..352 CDD:277360 124/298 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.