DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and BSL1

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_192217.2 Gene:BSL1 / 828097 AraportID:AT4G03080 Length:881 Species:Arabidopsis thaliana


Alignment Length:281 Identity:122/281 - (43%)
Similarity:172/281 - (61%) Gaps:20/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRIFKACGFPPKA------NYLFLGDY 89
            :..|.....::...:..:|:|:||:.:.||:||||.||:|:|...|||..|      :|||||||
plant   555 VGELCYAAEQIFMHEQTVLQLKAPIKVFGDLHGQFGDLMRLFDEYGFPSTAGDITYIDYLFLGDY 619

  Fly    90 VDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGF----YDEIKRRHTVRLWHSFTD 150
            ||||:.|||||.||.|.|::||.|..|:|||||:|.||.::||    .:.:.....:..|..|..
plant   620 VDRGQHSLETITLLLALKIEYPENVHLIRGNHEAADINALFGFRLECIERMGENDGIWAWTRFNQ 684

  Fly   151 CFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEG--IMCDLLWAD--LNHTTKG 211
            .||:||:|||:..:|.|.|||:..|:..::||..|:||..: |.|  ::.||||:|  .|.:.:|
plant   685 LFNYLPLAALIENKIICMHGGIGRSISTVEQIEKIERPITM-DAGSLVLMDLLWSDPTENDSIEG 748

  Fly   212 WGHNDRG---VSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFSAPNYCGMMN 273
            ...|.||   |:|..|:  |.:|.|...|||::||||.|.||:|.||..||:|:|||.||||..|
plant   749 LRPNARGPGLVTFGPDR--VTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYCGTAN 811

  Fly   274 NAGGVMSVSTDLICSFVIILP 294
            |||.::.|...|:....:|.|
plant   812 NAGAILVVGRGLVIVPKLIHP 832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 122/281 (43%)
MPP_PP1_PPKL 8..294 CDD:277359 121/279 (43%)
BSL1NP_192217.2 PLN02193 <21..>211 CDD:177844
KELCH repeat 30..92 CDD:276965
KELCH repeat 99..149 CDD:276965
KELCH repeat 152..201 CDD:276965
KELCH repeat 205..255 CDD:276965
MPP_Bsu1_C 530..832 CDD:277363 121/279 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.