DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and TOPP5

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_190266.1 Gene:TOPP5 / 823835 AraportID:AT3G46820 Length:312 Species:Arabidopsis thaliana


Alignment Length:291 Identity:183/291 - (62%)
Similarity:221/291 - (75%) Gaps:5/291 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IDCIIKELTSLNGSECTLKEEL-----IERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDL 68
            :|.||:.|......:...|:.:     |.:|...:||:...||.||||.|||.||||||||::||
plant    14 LDDIIRRLLDYRNPKAGTKQAMLNDSEIRQLCFVSREIFLQQPCLLELAAPVKICGDIHGQYSDL 78

  Fly    69 LRIFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFY 133
            ||:|:..||||.|||||||||||||||||||||||.|||:|||.||||||||||.||||:|||||
plant    79 LRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 143

  Fly   134 DEIKRRHTVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMC 198
            ||.|||..|:||..|||.||.|||||::.|:|.|.||||||.|.|::||.:|:||||:||.|::|
plant   144 DECKRRFNVKLWKVFTDTFNCLPVAAVIDEKILCMHGGLSPELINVEQIKNIERPTDVPDAGLLC 208

  Fly   199 DLLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVF 263
            ||||:|.:...||||.||||||:||....|.:||...|:.|:.|||:||||||||||:|||||:|
plant   209 DLLWSDPSKDVKGWGMNDRGVSYTFGADKVAEFLIKNDMDLVCRAHQVVEDGYEFFADRQLVTMF 273

  Fly   264 SAPNYCGMMNNAGGVMSVSTDLICSFVIILP 294
            |||||||..:|||.:|||...|:|||.|:.|
plant   274 SAPNYCGEFDNAGALMSVDESLMCSFQILKP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 183/291 (63%)
MPP_PP1_PPKL 8..294 CDD:277359 182/289 (63%)
TOPP5NP_190266.1 MPP_PP1_PPKL 13..304 CDD:277359 182/289 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.