DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and AT3G09970

DIOPT Version :10

Sequence 1:NP_476689.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_566364.1 Gene:AT3G09970 / 820158 AraportID:AT3G09970 Length:309 Species:Arabidopsis thaliana


Alignment Length:76 Identity:28/76 - (36%)
Similarity:37/76 - (48%) Gaps:8/76 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IC-GDIHGQFTDL--LRIFKACGFPP----KANYLFLGDYVDRGKQSLETICLLFAYKVKYP-LN 113
            || |||||..:.|  |.:.......|    .|..:|||||.|||.::.:.|..|.:...|:| ..
plant     9 ICVGDIHGYISKLNNLWLNLQSAIDPSDFSSALVIFLGDYCDRGPETRKVIDFLISLPEKHPDQT 73

  Fly   114 FFLLRGNHESA 124
            ...|.|||:.|
plant    74 HVFLAGNHDFA 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_476689.1 MPP_PP1_PPKL 8..294 CDD:277359 28/76 (37%)
AT3G09970NP_566364.1 MPP_Rhilphs 5..308 CDD:163664 28/76 (37%)

Return to query results.
Submit another query.