DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and AT3G09960

DIOPT Version :10

Sequence 1:NP_476689.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_566363.1 Gene:AT3G09960 / 820157 AraportID:AT3G09960 Length:311 Species:Arabidopsis thaliana


Alignment Length:77 Identity:27/77 - (35%)
Similarity:39/77 - (50%) Gaps:10/77 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IC-GDIHGQFTDLLRIF-------KACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYP-L 112
            || |||||..:.|.:::       :...| ..|..:|||||.|||.::.:.|..|.:...|:| .
plant    10 ICVGDIHGNISKLNKLWLNLQSDIQNSDF-SSALVIFLGDYCDRGPETRKVIDFLISLPEKHPDQ 73

  Fly   113 NFFLLRGNHESA 124
            ....|.|||:.|
plant    74 THVFLAGNHDFA 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_476689.1 MPP_PP1_PPKL 8..294 CDD:277359 27/77 (35%)
AT3G09960NP_566363.1 MPP_Rhilphs 6..310 CDD:163664 27/77 (35%)

Return to query results.
Submit another query.