DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Ppp6c

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_077171.1 Gene:Ppp6c / 67857 MGIID:1915107 Length:305 Species:Mus musculus


Alignment Length:255 Identity:108/255 - (42%)
Similarity:154/255 - (60%) Gaps:2/255 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRIFKACGFPPKANYLFLGDYV 90
            |.|..::||.....:::..:..:..:..||.:||||||||.||..:|:..|..|..||:|:||:|
Mouse    19 LPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFV 83

  Fly    91 DRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYDEIKRRH-TVRLWHSFTDCFNW 154
            |||..||||...|.|.|.|:|....||||||||..|.::||||||.:.:: ....|...|..|:.
Mouse    84 DRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDM 148

  Fly   155 LPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCDLLWADLNHTTKGWGHNDRGV 219
            |.||||:.|:|.|.||||||.::.|.||..|:|..:||.:|..|||:|:| ......|..:.||.
Mouse   149 LTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSD-PEDVDTWAISPRGA 212

  Fly   220 SFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFSAPNYCGMMNNAGGVM 279
            .:.|...:..:|:...:|:|:.|||::|.:||:|..:.:||||:||||||....|...:|
Mouse   213 GWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIM 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 108/255 (42%)
MPP_PP1_PPKL 8..294 CDD:277359 108/255 (42%)
Ppp6cNP_077171.1 MPP_PP2A_PP4_PP6 5..289 CDD:277360 108/255 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.