DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Ppp5c

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_006228527.2 Gene:Ppp5c / 65179 RGDID:68415 Length:594 Species:Rattus norvegicus


Alignment Length:263 Identity:106/263 - (40%)
Similarity:154/263 - (58%) Gaps:12/263 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IKWQPMLLELQAPVNICGDIHGQFTDLLRIFKACGFPPKAN-YLFLGDYVDRGKQSLETICLLFA 105
            ::| |:..:.: .:.:|||.||||.|||.||:..|.|.:.| |:|.||:||||..|:|.|..||.
  Rat   321 LRW-PLFFQTE-KITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFG 383

  Fly   106 YKVKYPLNFFLLRGNHESASINKIYGFYDEIKRRHTVRLWHSFTDCFNWLPVAALVGERIFCCHG 170
            :|:.||.:|.|||||||:.::|:||||..|:|.::|.:::..|::.|.|||:|..:..::...||
  Rat   384 FKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHG 448

  Fly   171 GL-SPSLRNLQQINHIQRPTDIPDEGIMCDLLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKA 234
            || |.....|..|..|:|....||.|.||||||:| .....|...:.||||..|...:.:.||:.
  Rat   449 GLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSD-PQPQNGRSVSKRGVSCQFGPDVTKAFLEE 512

  Fly   235 FDLQLMVRAHEVVEDGYEFFANRQLVTVFSAPNYCGMMNNAGGVMSV-STDLICSFVIILPCHKY 298
            ..|..::|:|||..:|||.....:.||||||||||..|.|....:.: .:||...|      |::
  Rat   513 NQLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQF------HQF 571

  Fly   299 KMI 301
            ..:
  Rat   572 TAV 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 106/263 (40%)
MPP_PP1_PPKL 8..294 CDD:277359 105/254 (41%)
Ppp5cXP_006228527.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.