DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Pp1-Y1

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster


Alignment Length:267 Identity:159/267 - (59%)
Similarity:198/267 - (74%) Gaps:0/267 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRIFKACGFPPKANYLFLGDYVDR 92
            |..|.:|::|.|:|:..:||||.::||||:.||||||:.||||.|:..|.|||..||.|||||||
  Fly    37 ESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLLRYFETSGHPPKKRYLMLGDYVDR 101

  Fly    93 GKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYDEIKRRHTVRLWHSFTDCFNWLPV 157
            ||.|:||:.||.||||:||.:..|||||||||:||:.||||||.|||.|:|||..|.||::.|||
  Fly   102 GKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYDECKRRFTIRLWRMFVDCYDCLPV 166

  Fly   158 AALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCDLLWADLNHTTKGWGHNDRGVSFT 222
            ||::..:||||||||||||.||..|.|:|||.::...|::|||||:|.:.|..||..|.||||||
  Fly   167 AAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCDLLWSDPDPTAIGWEKNSRGVSFT 231

  Fly   223 FDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFSAPNYCGMMNNAGGVMSVSTDLIC 287
            |...||..||..|...|:.|||:||||||||||.|||:|||||.||||..:|||.:|.|..:|..
  Fly   232 FGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFSAVNYCGEFDNAGAMMCVDAELNI 296

  Fly   288 SFVIILP 294
            :.|::.|
  Fly   297 TLVVMKP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 159/267 (60%)
MPP_PP1_PPKL 8..294 CDD:277359 158/265 (60%)
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 158/265 (60%)
PP2Ac 36..305 CDD:197547 159/267 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438772
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.