DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and PPP6C

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001116827.1 Gene:PPP6C / 5537 HGNCID:9323 Length:342 Species:Homo sapiens


Alignment Length:255 Identity:111/255 - (43%)
Similarity:152/255 - (59%) Gaps:6/255 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRIFKACGFPPKANYLFLGDYV 90
            |||.|.:.:.....|....||    :..||.:||||||||.||..:|:..|..|..||:|:||:|
Human    60 LKERLCDYVCDLLLEESNVQP----VSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFV 120

  Fly    91 DRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYDEIKRRH-TVRLWHSFTDCFNW 154
            |||..||||...|.|.|.|:|....||||||||..|.::||||||.:.:: ....|...|..|:.
Human   121 DRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDM 185

  Fly   155 LPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCDLLWADLNHTTKGWGHNDRGV 219
            |.||||:.|:|.|.||||||.::.|.||..|:|..:||.:|..|||:|:| ......|..:.||.
Human   186 LTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSD-PEDVDTWAISPRGA 249

  Fly   220 SFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFSAPNYCGMMNNAGGVM 279
            .:.|...:..:|:...:|:|:.|||::|.:||:|..:.:||||:||||||....|...:|
Human   250 GWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 111/255 (44%)
MPP_PP1_PPKL 8..294 CDD:277359 111/255 (44%)
PPP6CNP_001116827.1 MPP_PP2A_PP4_PP6 5..326 CDD:277360 111/255 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.