DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Pp1-87B

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster


Alignment Length:295 Identity:186/295 - (63%)
Similarity:227/295 - (76%) Gaps:4/295 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IDCIIKELTSLNGS----ECTLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLL 69
            ||.||..|..:.|:    ...|.|..|..|..::||:...||:||||:||:.||||||||:.|||
  Fly     7 IDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL 71

  Fly    70 RIFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYD 134
            |:|:..||||::||||||||||||||||||||||.|||:||..||||||||||.||||:||||||
  Fly    72 RLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYD 136

  Fly   135 EIKRRHTVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCD 199
            |.|||::::||.:||||||.|||||:|.|:||||||||||.|.:::||..|.||||:||:|::||
  Fly   137 ECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCD 201

  Fly   200 LLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFS 264
            |||:|.:..|.|||.|||||||||...:|..||:..:..|:.|||:||||||||||.|.|||:||
  Fly   202 LLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLFS 266

  Fly   265 APNYCGMMNNAGGVMSVSTDLICSFVIILPCHKYK 299
            ||||||..:|||.:|||...|:|||.|:.|..|.|
  Fly   267 APNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 186/295 (63%)
MPP_PP1_PPKL 8..294 CDD:277359 183/288 (64%)
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 183/288 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449146
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.