DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Pp4-19C

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster


Alignment Length:286 Identity:118/286 - (41%)
Similarity:180/286 - (62%) Gaps:8/286 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EIDCIIKELTSLNGSEC-TLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRI 71
            ::|..|::|     ..| .:||..::.|..:.||::..:..:..:.:||.:||||||||.||..:
  Fly     6 DLDRQIEQL-----KRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKEL 65

  Fly    72 FKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYDEI 136
            ||..|..|:.||||:||:||||..|:||..||.|.||:||....|:||||||..|.::||||||.
  Fly    66 FKVGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDEC 130

  Fly   137 KRRH-TVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCDL 200
            .|:: :..:|...|:.|::|.::|::..:|||.|||||||::.|.||..|.|..::|.:|.||||
  Fly   131 LRKYGSTAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDL 195

  Fly   201 LWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFSA 265
            ||:|....| |||.:.||..:.|...:|..|.:..|:.::.|||::|.:|:::..|..::||:||
  Fly   196 LWSDPEDQT-GWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSA 259

  Fly   266 PNYCGMMNNAGGVMSVSTDLICSFVI 291
            ||||....|...::.::..|...|||
  Fly   260 PNYCYRCGNVAAILELNEYLHRDFVI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 118/286 (41%)
MPP_PP1_PPKL 8..294 CDD:277359 118/286 (41%)
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 118/286 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438834
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D37653at7147
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.