DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and PpD5

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster


Alignment Length:290 Identity:170/290 - (58%)
Similarity:214/290 - (73%) Gaps:3/290 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EIDCIIKELTSL---NGSECTLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLL 69
            ::|.||.:|.::   |.....|.|..|..:.|.:||:...|||||||.|||.||||:||||.|||
  Fly    24 QLDVIIGQLKTMAVGNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLL 88

  Fly    70 RIFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYD 134
            |||:.||.||.:||||||||||||..|:||:.||..||::||..|||||||||||.:|::|||:|
  Fly    89 RIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFD 153

  Fly   135 EIKRRHTVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCD 199
            |.|||::::||.||.||::.:||||::.:||||.||||||.|.||..|..:.||||:|.:|::||
  Fly   154 ECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCD 218

  Fly   200 LLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFS 264
            |||:|.:.||..|..|||||||||...||..||......|:||||:||||||||||:|||||:||
  Fly   219 LLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFS 283

  Fly   265 APNYCGMMNNAGGVMSVSTDLICSFVIILP 294
            |||||.:.:|.|.|:.|...|:|.||||.|
  Fly   284 APNYCDIFDNCGAVLVVDAKLVCHFVIIRP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 170/290 (59%)
MPP_PP1_PPKL 8..294 CDD:277359 169/288 (59%)
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 170/290 (59%)
MPP_superfamily 25..313 CDD:301300 169/287 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438769
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3051
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.