DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Y71G12B.30

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001021823.2 Gene:Y71G12B.30 / 3565302 WormBaseID:WBGene00044347 Length:333 Species:Caenorhabditis elegans


Alignment Length:287 Identity:142/287 - (49%)
Similarity:190/287 - (66%) Gaps:11/287 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IIKELT-SLNGSEC-TL--KEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRIF 72
            :|..|| |.:...| ||  ::|:|| :..:.||....:||.||::|||.|||||||||.|||.:|
 Worm    19 VIFRLTQSWSPGNCQTLFQEKEIIE-ICYRAREAFWKEPMKLEIEAPVTICGDIHGQFEDLLSMF 82

  Fly    73 KACGFP------PKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYG 131
            ...|||      ..:.|||||||:|||..|:|.|.|||||::.:|...|||||||||..:|..||
 Worm    83 DIYGFPHVSQKDKSSRYLFLGDYIDRGPFSIEVITLLFAYRLLHPQKMFLLRGNHESRPVNMQYG 147

  Fly   132 FYDEIKRRHTVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGI 196
            ||:|.|||::|.|:.:|...|..:|:.|:||.||.|.|||:...|.:|:||:..||||||.|.||
 Worm   148 FYNECKRRYSVTLYETFQWAFYCMPLCAIVGGRIMCMHGGIPFGLLSLEQIDEFQRPTDIADVGI 212

  Fly   197 MCDLLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVT 261
            ..||.|||......|:..:.||....|.:..|::|.:.|.|.|:||||:||.|||||||:::|||
 Worm   213 PSDLCWADPVSGVVGFQDSPRGAGHVFGEATVKEFNEKFKLDLIVRAHQVVMDGYEFFADKKLVT 277

  Fly   262 VFSAPNYCGMMNNAGGVMSVSTDLICS 288
            :||||.|||..:|.|.|:.|:|::.|:
 Worm   278 IFSAPCYCGHFDNLGAVLQVATNMECT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 142/287 (49%)
MPP_PP1_PPKL 8..294 CDD:277359 142/287 (49%)
Y71G12B.30NP_001021823.2 PP2Ac 36..308 CDD:197547 135/270 (50%)
MPP_superfamily 36..304 CDD:301300 134/268 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156381
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.720

Return to query results.
Submit another query.