DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Ppef1

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_038955765.1 Gene:Ppef1 / 317498 RGDID:1562772 Length:664 Species:Rattus norvegicus


Alignment Length:319 Identity:91/319 - (28%)
Similarity:149/319 - (46%) Gaps:44/319 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTTHEIDCIIKELTSLNGSECTLKEELIERLIQQTREVIKWQPMLLELQA----PVNICGDIHGQ 64
            ||..:|:.:::...    .:.||....:..::.:.|:::|..|....:|.    .:.||||:||:
  Rat   141 LTFTDINLLLQAFK----QQQTLHAHYVLEVLFEARKILKQMPNFTRIQTFPAKEITICGDLHGK 201

  Fly    65 FTDLLRIFKACGFPPKAN-YLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINK 128
            ..||:.||...|.|.:.| |:|.||:||||..|:|.:.:|....:.||.:..|.|||||...:|.
  Rat   202 LDDLMLIFYKNGLPSEKNPYVFNGDFVDRGNNSMEILMILLVSFLVYPTDLHLNRGNHEDFMMNL 266

  Fly   129 IYGFYDEIKRR---HTVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPS--LRNLQQIN----- 183
            .|||..||.::   |..::.....:.:.|||:..::...|...|||:|.|  |..|||:.     
  Rat   267 RYGFTKEILQKYKLHGKKILQVLEELYTWLPIGTIIDNEILVIHGGISESTDLNILQQLQRNKMK 331

  Fly   184 -------------HIQRPTDIPDEGI------------MCDLLWADLNHTTKGWGHNDRGVSFTF 223
                         :|::....|.|..            :.||||:|.......:.:..||....|
  Rat   332 SVLMPPMSTNQECNIKKNKAGPSEQSASEQLTKLEWEQIIDLLWSDPRGKKGCYPNTSRGGGCYF 396

  Fly   224 DKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFSAPNYCGMMNNAGGVMSVS 282
            ...:....|....|::::|:||...||||...:.:::|||||.||....:|.|..:.:|
  Rat   397 GPDVTSKVLNKNQLKMVIRSHECKPDGYEICHDGKVITVFSASNYYEEGSNRGAYIRLS 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 89/315 (28%)
MPP_PP1_PPKL 8..294 CDD:277359 89/315 (28%)
Ppef1XP_038955765.1 IQ 40..>57 CDD:197470
MPP_RdgC 140..466 CDD:277364 91/319 (29%)
PTZ00183 505..647 CDD:185503
EF-hand_7 582..650 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.