DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and sds21

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001342764.1 Gene:sds21 / 2539179 PomBaseID:SPCC31H12.05c Length:322 Species:Schizosaccharomyces pombe


Alignment Length:300 Identity:184/300 - (61%)
Similarity:230/300 - (76%) Gaps:4/300 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HEIDCIIKELT-SLNG---SECTLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTD 67
            ::||.||::|. :.||   .:..|.:..|..|...:|.:...|||||||:||:.||||||||::|
pombe     3 YDIDAIIEKLVKARNGKPSKQVQLSDAEIRYLCTTSRSIFLSQPMLLELEAPLKICGDIHGQYSD 67

  Fly    68 LLRIFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGF 132
            |||:|:..|:||.||||||||||||||||||.||||||||:|||.||||||||||.||||:||||
pombe    68 LLRLFEYGGYPPDANYLFLGDYVDRGKQSLEVICLLFAYKIKYPENFFLLRGNHEFASINRIYGF 132

  Fly   133 YDEIKRRHTVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIM 197
            |||.|||::::||.:||||||.:||||::.|:|||.||||||.|.:|.||..|.|||||||.|::
pombe   133 YDECKRRYSIKLWKTFTDCFNCMPVAAVIDEKIFCMHGGLSPDLNSLDQIQRIIRPTDIPDTGLL 197

  Fly   198 CDLLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTV 262
            |||:|:|......|||.||||||:||...:|..||:..||.|:.|||:|||||||||..|||||:
pombe   198 CDLVWSDPEKDLTGWGENDRGVSYTFGADVVSRFLQKHDLDLICRAHQVVEDGYEFFGKRQLVTI 262

  Fly   263 FSAPNYCGMMNNAGGVMSVSTDLICSFVIILPCHKYKMIA 302
            ||||||||..:|.|.:|||:.||:|||.|:.|..|.:.::
pombe   263 FSAPNYCGEFDNVGAMMSVNEDLLCSFQILKPAEKRQRVS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 184/298 (62%)
MPP_PP1_PPKL 8..294 CDD:277359 182/289 (63%)
sds21NP_001342764.1 MPP_PP1_PPKL 4..294 CDD:277359 182/289 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.