DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Ppp2ca

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_058735.1 Gene:Ppp2ca / 24672 RGDID:3380 Length:309 Species:Rattus norvegicus


Alignment Length:289 Identity:128/289 - (44%)
Similarity:182/289 - (62%) Gaps:8/289 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTTHEIDCIIKELTSLNGSEC-TLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTD 67
            |.|.|:|..|::|     :|| .|.|..::.|.::.:|::..:..:.|::.||.:|||:||||.|
  Rat     5 LFTKELDQWIEQL-----NECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHD 64

  Fly    68 LLRIFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGF 132
            |:.:|:..|..|..||||:|||||||..|:||:.||.|.||:|.....:|||||||..|.::|||
  Rat    65 LMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGF 129

  Fly   133 YDEIKRRH-TVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGI 196
            |||..|:: ...:|..|||.|::||:.|||..:|||.|||||||:..|..|..:.|..::|.||.
  Rat   130 YDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGP 194

  Fly   197 MCDLLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVT 261
            ||||||:|.: ...|||.:.||..:||.:.|...|..|..|.|:.|||::|.:||.:..:|.:||
  Rat   195 MCDLLWSDPD-DRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVT 258

  Fly   262 VFSAPNYCGMMNNAGGVMSVSTDLICSFV 290
            :|||||||....|...:|.:...|..||:
  Rat   259 IFSAPNYCYRCGNQAAIMELDDTLKYSFL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 126/285 (44%)
MPP_PP1_PPKL 8..294 CDD:277359 126/285 (44%)
Ppp2caNP_058735.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 126/285 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.