DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Ppp1cc

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001257912.1 Gene:Ppp1cc / 24669 RGDID:3377 Length:337 Species:Rattus norvegicus


Alignment Length:307 Identity:193/307 - (62%)
Similarity:236/307 - (76%) Gaps:4/307 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVLTTHEIDCIIKELTSLNGSE----CTLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDI 61
            ||.:....||.||:.|..:.||:    ..|:|..|..|..::||:...||:||||:||:.|||||
  Rat     1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDI 65

  Fly    62 HGQFTDLLRIFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASI 126
            |||:.||||:|:..||||::||||||||||||||||||||||.|||:|||.||||||||||.|||
  Rat    66 HGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASI 130

  Fly   127 NKIYGFYDEIKRRHTVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDI 191
            |:|||||||.|||:.::||.:||||||.||:||:|.|:||||||||||.|::::||..|.||||:
  Rat   131 NRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDV 195

  Fly   192 PDEGIMCDLLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFAN 256
            ||:|::|||||:|.:....|||.|||||||||...:|..||...||.|:.|||:||||||||||.
  Rat   196 PDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAK 260

  Fly   257 RQLVTVFSAPNYCGMMNNAGGVMSVSTDLICSFVIILPCHKYKMIAT 303
            |||||:||||||||..:|||.:|||...|:|||.|:.|..|.|..||
  Rat   261 RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNAT 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 191/300 (64%)
MPP_PP1_PPKL 8..294 CDD:277359 186/289 (64%)
Ppp1ccNP_001257912.1 MPP_PP1_PPKL 8..298 CDD:277359 186/289 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.