DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Ppp1ca

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_113715.1 Gene:Ppp1ca / 24668 RGDID:3375 Length:330 Species:Rattus norvegicus


Alignment Length:295 Identity:188/295 - (63%)
Similarity:229/295 - (77%) Gaps:4/295 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IDCIIKELTSLNGS----ECTLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLL 69
            :|.||..|..:.||    ...|.|..|..|..::||:...||:||||:||:.||||||||:.|||
  Rat     9 LDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL 73

  Fly    70 RIFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYD 134
            |:|:..||||::||||||||||||||||||||||.|||:|||.||||||||||.||||:||||||
  Rat    74 RLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD 138

  Fly   135 EIKRRHTVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCD 199
            |.|||:.::||.:||||||.||:||:|.|:||||||||||.|::::||..|.||||:||:|::||
  Rat   139 ECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCD 203

  Fly   200 LLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFS 264
            |||:|.:...:|||.|||||||||...:|..||...||.|:.|||:||||||||||.|||||:||
  Rat   204 LLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFS 268

  Fly   265 APNYCGMMNNAGGVMSVSTDLICSFVIILPCHKYK 299
            ||||||..:|||.:|||...|:|||.|:.|..|.|
  Rat   269 APNYCGEFDNAGAMMSVDETLMCSFQILKPADKNK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 188/295 (64%)
MPP_PP1_PPKL 8..294 CDD:277359 185/288 (64%)
Ppp1caNP_113715.1 MPP_PP1_PPKL 8..298 CDD:277359 185/288 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340875
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.