DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Ppp1cb

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_766295.2 Gene:Ppp1cb / 19046 MGIID:104871 Length:327 Species:Mus musculus


Alignment Length:293 Identity:186/293 - (63%)
Similarity:227/293 - (77%) Gaps:4/293 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IDCIIKELTSLNGSE----CTLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLL 69
            :|.:|..|..:.|..    ..:.|..:..|..::||:...||:||||:||:.||||||||:||||
Mouse     8 VDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLL 72

  Fly    70 RIFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYD 134
            |:|:..||||:|||||||||||||||||||||||.|||:|||.||||||||||.||||:||||||
Mouse    73 RLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD 137

  Fly   135 EIKRRHTVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCD 199
            |.|||..::||.:||||||.||:||:|.|:||||||||||.|::::||..|.||||:||.|::||
Mouse   138 ECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCD 202

  Fly   200 LLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFS 264
            |||:|.:...:|||.|||||||||...:|..||...||.|:.|||:||||||||||.|||||:||
Mouse   203 LLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFS 267

  Fly   265 APNYCGMMNNAGGVMSVSTDLICSFVIILPCHK 297
            ||||||..:||||:|||...|:|||.|:.|..|
Mouse   268 APNYCGEFDNAGGMMSVDETLMCSFQILKPSEK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 186/293 (63%)
MPP_PP1_PPKL 8..294 CDD:277359 184/288 (64%)
Ppp1cbNP_766295.2 MPP_PP1_PPKL 7..297 CDD:277359 184/288 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.