DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Y40H4A.2

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_506609.2 Gene:Y40H4A.2 / 189799 WormBaseID:WBGene00012741 Length:333 Species:Caenorhabditis elegans


Alignment Length:252 Identity:108/252 - (42%)
Similarity:159/252 - (63%) Gaps:9/252 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PVNICGDIHGQFTDLLRIFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLR 118
            ||:|.||:||.|.||.|||...|.|..::|:|||||||||:|.:||:.||.||...||.:.||.|
 Worm    79 PVHIVGDLHGHFGDLRRIFGIHGAPGISHYVFLGDYVDRGRQGIETVMLLMAYHCLYPDHLFLCR 143

  Fly   119 GNHESASINKIYGFYDEIKRRHTVR---LWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQ 180
            ||||..:....|||:||.:.::..:   .|....:.||.||:|||:.:::.|.|||:||.::.|:
 Worm   144 GNHEDYNTTMTYGFFDECRMKYGKKGTLAWLHIINAFNHLPLAALILDKVLCMHGGISPHIQKLE 208

  Fly   181 QINHIQRPTDIPDEGIMCDLLWADLNHTTK-GWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAH 244
            .|:.|||||.||..|:.|||:|:|...|:. ||..:.||:||:||.:.:..|.:...|.|:||||
 Worm   209 DIDKIQRPTFIPSYGLACDLVWSDPEKTSNVGWSLSARGISFSFDDITIEKFCQDNGLDLIVRAH 273

  Fly   245 ----EVVEDGYEFFANRQLVTVFSAPNYCGMMNNAGGVMSVSTDLICSFVIILPCHK 297
                |::..|:::.||.::||:|||.||..|.|:: .|:.:.......|.::.|..|
 Worm   274 QISSEMIRGGHKWHANGRMVTIFSAANYLSMGNDS-CVIRIDEQKTMQFCLLRPVKK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 108/252 (43%)
MPP_PP1_PPKL 8..294 CDD:277359 106/247 (43%)
Y40H4A.2NP_506609.2 PP2Ac 49..328 CDD:197547 107/249 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.