DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and C25A6.1

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_504432.3 Gene:C25A6.1 / 178923 WormBaseID:WBGene00016081 Length:300 Species:Caenorhabditis elegans


Alignment Length:291 Identity:141/291 - (48%)
Similarity:186/291 - (63%) Gaps:19/291 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IDCIIKELTSLNGSECTLKEELIE----RLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLL 69
            :|.||.::.|.:..|..|.|.:.|    :|:....:|.|.|..::|:.||:.:||||||||.|||
 Worm     6 VDNIIIDVLSASTHEKLLSEVITEGRVLKLLDLALDVFKRQKSMVEMNAPIKVCGDIHGQFPDLL 70

  Fly    70 RIFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYD 134
            |:|...|:||.|||||||||||||:.|:|||.||.|||||:|.|.||||||||...:||:||||:
 Worm    71 RLFHRGGWPPTANYLFLGDYVDRGRFSIETIVLLLAYKVKFPGNLFLLRGNHECEFVNKVYGFYE 135

  Fly   135 EIKRRH-TVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMC 198
            |.::|: :||::.:|.|.|||||:..|:..:|.|.|||||||        |..:      |.::.
 Worm   136 ECQKRYQSVRMFTAFQDVFNWLPLCGLIANKILCMHGGLSPS--------HDGK------ERLVA 186

  Fly   199 DLLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVF 263
            ||||||......|:..|:||....|.:..|......|.|.|:.|||:||:|||||||.|:|||:|
 Worm   187 DLLWADPISGLSGFMENNRGAGCGFGRDAVLKVCSDFKLDLICRAHQVVQDGYEFFAGRKLVTIF 251

  Fly   264 SAPNYCGMMNNAGGVMSVSTDLICSFVIILP 294
            |||:|||..:|....||....|.|||.|:.|
 Worm   252 SAPHYCGQFDNCAAFMSCDEKLQCSFEILRP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 141/291 (48%)
MPP_PP1_PPKL 8..294 CDD:277359 140/289 (48%)
C25A6.1NP_504432.3 MPP_superfamily 5..282 CDD:301300 140/289 (48%)
PP2Ac 32..284 CDD:197547 133/265 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156446
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.