DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and C06A1.3

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_496276.1 Gene:C06A1.3 / 174626 WormBaseID:WBGene00007354 Length:364 Species:Caenorhabditis elegans


Alignment Length:291 Identity:124/291 - (42%)
Similarity:183/291 - (62%) Gaps:8/291 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DCIIKELTSL----NGSECTLK--EELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDL 68
            || ||.:.||    |.:.|.:.  .|:|. :|:....:...:..|.|.:||:.:.||||.|:.|:
 Worm    39 DC-IKRMNSLYKDTNINICNVMTGHEIIS-IIRMVEAIFMEESNLCEAEAPIKVIGDIHAQYQDM 101

  Fly    69 LRIFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFY 133
            .|:|...|..|:...:|||||||||.|.:|.:.|||..|::|....:|||||||:.|:|||||||
 Worm   102 NRLFDLIGRVPEEKLMFLGDYVDRGPQGIEVLILLFCLKIRYRDRIYLLRGNHETPSVNKIYGFY 166

  Fly   134 DEIKRRHTVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMC 198
            .|.:.::.:.||..|..|||.:|::.|:.:|:.|.||||||.|.||..|.:|.||.:..|.|::.
 Worm   167 VECQYKYGIGLWWDFQSCFNRMPMSGLISKRVLCMHGGLSPELINLDTIRNIPRPCEPLDRGLLI 231

  Fly   199 DLLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVF 263
            ||||:|..:..:||.|:.||:|:.|.|.:|....|:.::.|::|||:||:||||....|:|:|||
 Worm   232 DLLWSDPTNKGEGWFHSIRGISYMFGKGVVEQACKSLEIDLIIRAHQVVQDGYEMMTGRRLITVF 296

  Fly   264 SAPNYCGMMNNAGGVMSVSTDLICSFVIILP 294
            |.||||....||..|:.::.:|..||..::|
 Worm   297 SVPNYCAQFTNAAAVVCLNANLQISFQQMIP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 124/291 (43%)
MPP_PP1_PPKL 8..294 CDD:277359 123/289 (43%)
C06A1.3NP_496276.1 MPP_superfamily 37..327 CDD:301300 123/289 (43%)
PP2Ac 59..329 CDD:197547 116/270 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156369
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.