DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and Ppp4c

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_599186.1 Gene:Ppp4c / 171366 RGDID:621225 Length:307 Species:Rattus norvegicus


Alignment Length:285 Identity:120/285 - (42%)
Similarity:180/285 - (63%) Gaps:3/285 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EIDCIIKELTSLNGSECTLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRIF 72
            ||..:.:::..|...| .:||..::.|..:.||::..:..:..:.:||.:||||||||.||..:|
  Rat     3 EISDLDRQIEQLRRCE-LIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELF 66

  Fly    73 KACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYDEIK 137
            :..|..|:.||||:||:||||..|:||..||.|.||:||....|:||||||..|.::||||||..
  Rat    67 RVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECL 131

  Fly   138 RRH-TVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCDLL 201
            |:: :|.:|...|:.|::|.::|::..:|||.|||||||::.|.||..|.|..::|.:|.|||||
  Rat   132 RKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLL 196

  Fly   202 WADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFSAP 266
            |:|...|| |||.:.||..:.|...:|..|..|.|:.:..|||::|.:||::..|..::||:|||
  Rat   197 WSDPEDTT-GWGVSPRGAGYLFGSDVVAQFNAANDIDMTCRAHQLVMEGYKWHFNETVLTVWSAP 260

  Fly   267 NYCGMMNNAGGVMSVSTDLICSFVI 291
            |||....|...::.:...|...|:|
  Rat   261 NYCYRCGNVAAILELDEHLQKDFII 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 120/285 (42%)
MPP_PP1_PPKL 8..294 CDD:277359 120/285 (42%)
Ppp4cNP_599186.1 PTZ00239 6..307 CDD:173488 118/282 (42%)
MPP_PP2A_PP4_PP6 6..290 CDD:277360 118/282 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.