DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and ppef1

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_031752607.1 Gene:ppef1 / 100496625 XenbaseID:XB-GENE-6037564 Length:700 Species:Xenopus tropicalis


Alignment Length:380 Identity:100/380 - (26%)
Similarity:164/380 - (43%) Gaps:97/380 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTTHEIDCIIKELTSLNGSECTLKEELIERLIQQTREVIKWQPMLLELQA----PVNICGDIHGQ 64
            ||..:.:.:::...  .|.:  |....:.:|..:|::.:|..|.::.|..    .:.||||:||:
 Frog   122 LTVSDTNALLRAFK--QGQQ--LHARYVLQLFHETKKFLKQLPNIVHLSTSYSKEITICGDLHGK 182

  Fly    65 FTDLLRIFKACGFPPKAN-YLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINK 128
            ..|||.||...|.|...| |||.||.|||||.|:|.:.|||.:.:.||.|..:.|||||...:|.
 Frog   183 LDDLLLIFYKNGLPSTENHYLFNGDLVDRGKNSIEILVLLFTFLLMYPNNVHINRGNHEDPIMNL 247

  Fly   129 IYGFYDEIKRR---HTVRLWHSFTDCFNWLPVAALVGERIFCCHGGL-----------------S 173
            .|||.:|:.::   |...:.....|.::.||:|.:|..::...|||:                 .
 Frog   248 RYGFTNEVIQKYKGHARNILLLLEDIYSRLPLATIVDSKVLILHGGIGDKTDLDFLSSIDRFKYK 312

  Fly   174 PSLR------------------------------------------NLQQ--------------I 182
            .:||                                          |:.|              |
 Frog   313 SALRTPKTDSEKCTSRDKMLDGKNKKSSVDVGANQNRANKHMTTSSNISQNRSQQGFRSPGILEI 377

  Fly   183 NH----IQRPTDIPD--EGI------MCDLLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAF 235
            |:    ||.|..:|:  :.|      :.|:||:|..:......::.||....|...:.:..|..:
 Frog   378 NYMDSRIQLPDKMPELPDSIRKEWKQVVDILWSDPRNQNGCTPNSFRGGGCYFGPNVTKKLLAKY 442

  Fly   236 DLQLMVRAHEVVEDGYEFFANRQLVTVFSAPNYCGMMNNAGGVMSVSTDLICSFV 290
            :.::::|:||..::|||...|.::||:|||.||....:|.|..:.:|.||...||
 Frog   443 NFKMLIRSHECKQEGYELCHNGKVVTIFSASNYYDEGSNRGAYLKLSPDLTPRFV 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 98/376 (26%)
MPP_PP1_PPKL 8..294 CDD:277359 98/376 (26%)
ppef1XP_031752607.1 MPP_superfamily 121..500 CDD:417454 100/380 (26%)
FRQ1 535..683 CDD:227455
EF-hand_7 616..684 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.