DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpY-55A and ppp3cb

DIOPT Version :9

Sequence 1:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_012813808.1 Gene:ppp3cb / 100037840 XenbaseID:XB-GENE-949827 Length:531 Species:Xenopus tropicalis


Alignment Length:289 Identity:110/289 - (38%)
Similarity:167/289 - (57%) Gaps:27/289 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ECTLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRIFKACGFPPKANYLFLG 87
            |..|:||...|:|::...:::.:..:||::||:.:||||||||.||:::|:..|.|....|||||
 Frog    75 EGRLEEEAALRIIREGAAILRQEKTMLEVEAPITVCGDIHGQFFDLMKLFEVGGTPHNTRYLFLG 139

  Fly    88 DYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYDEIKRRHTVRLWHSFTDCF 152
            ||||||..|:|.:..|::.|:.:|...||||||||...:.:.:.|..|.|.:::.|::.|..|.|
 Frog   140 DYVDRGYFSIECVLYLWSLKIIHPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDSCMDAF 204

  Fly   153 NWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCDLLWAD----------LNH 207
            :.||:|||:.::..|.||||||.:..|..|..:.|..:.|..|.||||||:|          |.|
 Frog   205 DCLPLAALLNQQFLCVHGGLSPEITCLDDIRKLDRFKEPPAFGPMCDLLWSDPAEDYGSEKTLEH 269

  Fly   208 TTKGWGHND-RGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQ------LVTVFSA 265
            .|    ||. ||.|:.:....|.:||::.:|..::||||..:.||..:...|      |:|:|||
 Frog   270 FT----HNTVRGCSYFYSYPAVCEFLQSNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSA 330

  Fly   266 PNYCGMMNNAGGVMSVSTDLI------CS 288
            |||..:.||...|:....:::      ||
 Frog   331 PNYLDVYNNKAAVLKYENNVMNIRQFNCS 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 110/289 (38%)
MPP_PP1_PPKL 8..294 CDD:277359 110/289 (38%)
ppp3cbXP_012813808.1 MPP_PP2B 63..367 CDD:277361 110/289 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.