DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and PPQ1

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_015146.1 Gene:PPQ1 / 855923 SGDID:S000006100 Length:549 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:176/308 - (57%)
Similarity:224/308 - (72%) Gaps:8/308 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVLNLESIISRLLEVRGAR------PGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICG 61
            |.|:::..|.:||:|..:|      ..||......||:.:|..:|||.|.||.||.|:||:|:.|
Yeast   236 EGLDIDVAIEKLLQVGESREITKTSKKKNFPFHSWEIQLICYHAREIFLNQPTLLRLQAPIKVVG 300

  Fly    62 DIHGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECA 126
            |:|||:.||||:.:..|.|.:.|||||||||||||.|||||.|||.|||||.:|||:||||||.|
Yeast   301 DVHGQFNDLLRILKLSGVPSDTNYLFLGDYVDRGKNSLETILLLLCYKIKYKDNFFMLRGNHESA 365

  Fly   127 SINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPT 191
            ::.::||||||||||.:.|:||.|.|.||.||:.||:.:||||.|||:||||..|:||.::.|||
Yeast   366 NVTKMYGFYDECKRRLSSKVWKMFVDVFNTLPLAAIIQDKIFCVHGGISPDLHDMKQIEKVARPT 430

  Fly   192 DVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFF 256
            |:|:.||:.||||||||.....|.|||||||:||....|:.|..|...|||.|.|.|||||||||
Yeast   431 DIPESGLVTDLLWSDPDPQVTDWSENDRGVSYTFSKRNVLDFCAKFKFDLILRGHMVVEDGYEFF 495

  Fly   257 AKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKP--VEKRKK 302
            |:::.||:||||||||||.|.||:|||...:||||::|||  ::.:||
Yeast   496 ARKKFVTIFSAPNYCGEFHNWGAVMSVTTGMMCSFELLKPRALKNKKK 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 173/301 (57%)
MPP_PP1_PPKL 6..296 CDD:277359 170/295 (58%)
PPQ1NP_015146.1 MPP_PP1_PPKL 239..535 CDD:277359 170/295 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.