Sequence 1: | NP_524921.1 | Gene: | Pp1-13C / 48531 | FlyBaseID: | FBgn0003132 | Length: | 302 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014182.1 | Gene: | PPN2 / 855504 | SGDID: | S000005161 | Length: | 326 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 195 | Identity: | 40/195 - (20%) |
---|---|---|---|
Similarity: | 72/195 - (36%) | Gaps: | 50/195 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 GDIHGQYYDLLRLFE--YGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNH 123
Fly 124 E----CASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDL--TSME 182
Fly 183 QIRR----------------------------IMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDR 219
Fly 220 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pp1-13C | NP_524921.1 | PTZ00480 | 5..299 | CDD:185658 | 40/195 (21%) |
MPP_PP1_PPKL | 6..296 | CDD:277359 | 40/195 (21%) | ||
PPN2 | NP_014182.1 | MPP_PPP_family | 64..307 | CDD:277316 | 40/195 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0639 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |