DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and PPN2

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_014182.1 Gene:PPN2 / 855504 SGDID:S000005161 Length:326 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:40/195 - (20%)
Similarity:72/195 - (36%) Gaps:50/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GDIHGQYYDLLRLFE--YGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNH 123
            ||:||.|.:.:.|.:  .||.......:.|||::.:|..|.:.:    :|.:.:.:....:.|||
Yeast    67 GDVHGNYDEFIELIDDKIGGLGENITMILLGDFIHKGPDSDKVV----SYILNHKDQVKCVLGNH 127

  Fly   124 E----CASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDL--TSME 182
            |    .|.:|   ..:.:..||..:....||:...|.:|...   .||...||.|:.:|  :.:.
Yeast   128 EILVMMAYLN---PDFSKWVRRPKLMTPLTFSTETNFIPQDI---SKISNAHGRLARELGFSKLS 186

  Fly   183 QIRR----------------------------IMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDR 219
            |:..                            .|:|..:|....|.::.:.|..    .|.:..|
Yeast   187 QLAEHCSMAIELDLDITGDILFGAHAGMVPGDFMKPNQIPGVSSLSNMKYVDKK----NWSKTSR 247

  Fly   220  219
            Yeast   248  247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 40/195 (21%)
MPP_PP1_PPKL 6..296 CDD:277359 40/195 (21%)
PPN2NP_014182.1 MPP_PPP_family 64..307 CDD:277316 40/195 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.