DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and PPZ2

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_010724.1 Gene:PPZ2 / 852046 SGDID:S000002844 Length:710 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:190/295 - (64%)
Similarity:225/295 - (76%) Gaps:1/295 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LNLESIISRLLEV-RGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYY 68
            ::::.||.|||:. ..|:..|||.|...||..:|.|:||:.||||.||||...:||.||:||||.
Yeast   396 VDIDEIIQRLLDAGYAAKRTKNVCLKNSEIIQICHKARELFLAQPALLELSPSVKIVGDVHGQYA 460

  Fly    69 DLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYG 133
            ||||||...|:||.||||||||||||||||||||.|||.|||||.|||||||||||||::.|:||
Yeast   461 DLLRLFTKCGFPPMANYLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYG 525

  Fly   134 FYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGL 198
            ||||||||..||:||||.|.||.||:.|||..||||.||||||.|.||::||.:.|||||||.||
Yeast   526 FYDECKRRCNIKIWKTFVDTFNTLPLAAIVTGKIFCVHGGLSPVLNSMDEIRHVSRPTDVPDFGL 590

  Fly   199 LCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVT 263
            :.|||||||...:..|.:|:|||||.:....:.|||.|...||:||||.|||||||||..|.|||
Yeast   591 INDLLWSDPTDSSNEWEDNERGVSFCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVT 655

  Fly   264 LFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVE 298
            :||||||||||||.||:|:|...|:|||::|.|::
Yeast   656 VFSAPNYCGEFDNWGAVMTVSEGLLCSFELLDPLD 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 190/295 (64%)
MPP_PP1_PPKL 6..296 CDD:277359 189/290 (65%)
PPZ2NP_010724.1 MPP_PP1_PPKL 397..688 CDD:277359 189/290 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.