DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and PPH22

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_010093.1 Gene:PPH22 / 851339 SGDID:S000002347 Length:377 Species:Saccharomyces cerevisiae


Alignment Length:258 Identity:128/258 - (49%)
Similarity:178/258 - (68%) Gaps:2/258 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLGDYV 92
            |||.::..||..:.::|..:..:..:..|:.||||:|||::|||.||:.||..|:.||||:||||
Yeast    91 LSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYV 155

  Fly    93 DRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRY-TIKLWKTFTDCFNC 156
            |||..|:||:..|:|.|::|.....:||||||...|.::|||||||.|:| :..:||.|||.|:.
Yeast   156 DRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDY 220

  Fly   157 LPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGV 221
            .||.|:||.||||.||||||.:.:::|:|.:.|..:||.:|.:||||||||| |..|||.:.||.
Yeast   221 FPVTALVDNKIFCLHGGLSPMIETIDQVRDLNRIQEVPHEGPMCDLLWSDPD-DRGGWGISPRGA 284

  Fly   222 SFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVD 284
            .||||.::..:|...:||.||.||||:|.:||.:..::.:||:|||||||....|..|:|.||
Yeast   285 GFTFGQDISEQFNHTNDLSLIARAHQLVMEGYSWSHQQNVVTIFSAPNYCYRCGNQAAIMEVD 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 128/258 (50%)
MPP_PP1_PPKL 6..296 CDD:277359 128/258 (50%)
PPH22NP_010093.1 MPP_PP2A_PP4_PP6 78..360 CDD:277360 128/258 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.