DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and CNA1

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_013537.1 Gene:CNA1 / 851153 SGDID:S000004425 Length:553 Species:Saccharomyces cerevisiae


Alignment Length:284 Identity:113/284 - (39%)
Similarity:167/284 - (58%) Gaps:24/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLGDY 91
            :||:.:...:...|...|..:|.||:|:||:.|||||||||||||:|||.||.|.|.:|||||||
Yeast    84 RLSKEQAIKILNMSTVALSKEPNLLKLKAPITICGDIHGQYYDLLKLFEVGGDPAEIDYLFLGDY 148

  Fly    92 VDRGKQSLETICLLLAYKIKYSE--NFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCF 154
            ||||..|.|  ||:..|.:|.:.  .|::|||||||..:...:.|.:|...:|.::::......|
Yeast   149 VDRGAFSFE--CLIYLYSLKLNNLGRFWMLRGNHECKHLTSYFTFKNEMLHKYDMEVYDACCRSF 211

  Fly   155 NCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDP--------DKDT 211
            |.||:.|:::.:.||.|||:||:|.|:|.:.:|.|..::|.:||:|||||:||        |...
Yeast   212 NVLPLAALMNGQYFCVHGGISPELKSVEDVNKINRFREIPSRGLMCDLLWADPVENYDDARDGSE 276

  Fly   212 IGWGEND------RGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQ------LVTL 264
            ....|::      ||.||.|..:...|||:.:.|..|.|||:..:.||..:...:      |:|:
Yeast   277 FDQSEDEFVPNSLRGCSFAFTFKASCKFLKANGLLSIIRAHEAQDAGYRMYKNNKVTGFPSLITM 341

  Fly   265 FSAPNYCGEFDNAGAMMSVDNTLM 288
            ||||||...:.|..|::..:..:|
Yeast   342 FSAPNYLDTYHNKAAVLKYEENVM 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 113/284 (40%)
MPP_PP1_PPKL 6..296 CDD:277359 113/284 (40%)
CNA1NP_013537.1 MPP_PP2B 70..381 CDD:277361 113/284 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.