DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and TOPP1

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_180501.1 Gene:TOPP1 / 817489 AraportID:AT2G29400 Length:318 Species:Arabidopsis thaliana


Alignment Length:296 Identity:230/296 - (77%)
Similarity:260/296 - (87%) Gaps:3/296 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LESIISRLLEVRGARP--GKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYD 69
            |:.||.||:|.|..||  ||.|.|||||||.||..|:||.|.||.|||||||:||||||||||.|
plant    20 LDDIIRRLVEFRNTRPGSGKQVHLSEGEIRQLCAVSKEIFLQQPNLLELEAPIKICGDIHGQYSD 84

  Fly    70 LLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGF 134
            |||||||||:|||||||||||||||||||||||||||||||||.|||||||||||.|||||||||
plant    85 LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHESASINRIYGF 149

  Fly   135 YDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLL 199
            |||||||:.::|||.||||||||||.|::|::|.|.|||:||:|.|::|||.|.||.|:|:.||:
plant   150 YDECKRRFNVRLWKIFTDCFNCLPVAALIDDRILCMHGGISPELKSLDQIRNIARPMDIPESGLV 214

  Fly   200 CDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTL 264
            ||||||||..| :|||.||||||:||||:.|.:||:|||:||||||||||||||||||:|||||:
plant   215 CDLLWSDPSGD-VGWGMNDRGVSYTFGADKVAEFLEKHDMDLICRAHQVVEDGYEFFAERQLVTV 278

  Fly   265 FSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKR 300
            ||||||||||||||||||:|.:||||||||||.||:
plant   279 FSAPNYCGEFDNAGAMMSIDESLMCSFQILKPSEKK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 228/293 (78%)
MPP_PP1_PPKL 6..296 CDD:277359 226/290 (78%)
TOPP1NP_180501.1 MPP_PP1_PPKL 19..310 CDD:277359 226/290 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 356 1.000 Domainoid score I201
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 514 1.000 Inparanoid score I297
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - mtm1134
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.