DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and Ppp5c

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_006228527.2 Gene:Ppp5c / 65179 RGDID:68415 Length:594 Species:Rattus norvegicus


Alignment Length:244 Identity:105/244 - (43%)
Similarity:152/244 - (62%) Gaps:4/244 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEAN-YLFLGDYVDRGKQSLETICLLLAY 108
            |..|:..:.| .:.:|||.|||:||||.:||..|.|.|.| |:|.||:||||..|:|.|..|..:
  Rat   321 LRWPLFFQTE-KITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGF 384

  Fly   109 KIKYSENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGG 173
            |:.|.::|.|||||||..::|:||||..|.|.:||.::::.|::.|..||:...::.|:...|||
  Rat   385 KLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGG 449

  Fly   174 L-SPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKH 237
            | |.|..:::.||:|.|....||.|.:||||||||.... |...:.||||..||.:|...||:::
  Rat   450 LFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQN-GRSVSKRGVSCQFGPDVTKAFLEEN 513

  Fly   238 DLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNT 286
            .||.|.|:|:|..:|||.....:.||:|||||||.:..|..:.:.:..:
  Rat   514 QLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGS 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 105/244 (43%)
MPP_PP1_PPKL 6..296 CDD:277359 105/244 (43%)
Ppp5cXP_006228527.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.