DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and Ppp4c

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001347393.1 Gene:Ppp4c / 56420 MGIID:1891763 Length:307 Species:Mus musculus


Alignment Length:303 Identity:139/303 - (45%)
Similarity:201/303 - (66%) Gaps:12/303 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEVLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHG 65
            |||:.:|:..|.:|....        .:.|.|::.||.|:||||:.:..:..:::|:.:||||||
Mouse     1 MAEISDLDRQIEQLRRCE--------LIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHG 57

  Fly    66 QYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINR 130
            |:|||..||..||..||.||||:||:||||..|:||..||||.|::|.:...|:|||||...|.:
Mouse    58 QFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQ 122

  Fly   131 IYGFYDECKRRY-TIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVP 194
            :|||||||.|:| ::.:|:..|:.|:.|.:.||:|.||||.||||||.:.:::|||.|.|..:||
Mouse   123 VYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVP 187

  Fly   195 DQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKR 259
            ..|.:||||||||: ||.|||.:.||..:.||::||.:|...:|:|:||||||:|.:||::....
Mouse   188 HDGPMCDLLWSDPE-DTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNE 251

  Fly   260 QLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILK--PVEKR 300
            .::|::||||||....|..|::.:|..|...|.|.:  |.|.|
Mouse   252 TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 134/296 (45%)
MPP_PP1_PPKL 6..296 CDD:277359 133/292 (46%)
Ppp4cNP_001347393.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 133/292 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.