DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and PPP3CB

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001135825.1 Gene:PPP3CB / 5532 HGNCID:9315 Length:525 Species:Homo sapiens


Alignment Length:294 Identity:114/294 - (38%)
Similarity:172/294 - (58%) Gaps:30/294 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KNVQLSEGEI-RGLCLK----SREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEA 83
            ||..:.||.: ..:.|:    ...||..:..::|:|||:.:|||||||::||::|||.||.|...
Human    56 KNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT 120

  Fly    84 NYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYTIKLWK 148
            .|||||||||||..|:|.:..|...||.|....|||||||||..:...:.|..|||.:|:.::::
Human   121 RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYE 185

  Fly   149 TFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIG 213
            ...:.|:.||:.|:::::..|.||||||::.:::.|||:.|..:.|..|.:||||||||.:|   
Human   186 ACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSED--- 247

  Fly   214 WGEND----------RGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQ------LV 262
            :|...          ||.|:.:....|.:|||.::|..|.|||:..:.||..:.|.|      |:
Human   248 FGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLI 312

  Fly   263 TLFSAPNYCGEFDNAGAMMSVDNTLM------CS 290
            |:||||||...::|..|::..:|.:|      ||
Human   313 TIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 114/294 (39%)
MPP_PP1_PPKL 6..296 CDD:277359 114/294 (39%)
PPP3CBNP_001135825.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
MPP_PP2B 50..354 CDD:277361 114/294 (39%)
Catalytic. /evidence=ECO:0000305 65..356 110/285 (39%)
SAPNY motif. /evidence=ECO:0000250|UniProtKB:Q08209 316..320 3/3 (100%)
Calcineurin B binding. /evidence=ECO:0000269|PubMed:26794871 357..379
Calmodulin-binding. /evidence=ECO:0000269|PubMed:26794871 402..416
Autoinhibitory segment. /evidence=ECO:0000269|PubMed:26794871 417..424
Autoinhibitory domain. /evidence=ECO:0000269|PubMed:26794871 475..497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.