DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and PPEF1

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001364915.1 Gene:PPEF1 / 5475 HGNCID:9243 Length:653 Species:Homo sapiens


Alignment Length:332 Identity:98/332 - (29%)
Similarity:153/332 - (46%) Gaps:81/332 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KSREILLAQPILLELE-APLK---ICGDIHGQYYDLLRLFEYGGYPPEAN-YLFLGDYVDRGKQS 98
            :::::|...|....:: :|.|   ||||:||:..||..:|...|.|.|.| |:|.||:|||||.|
Human   145 ETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNS 209

  Fly    99 LETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYTI---KLWKTFTDCFNCLPVV 160
            :|.:.:|....:.|..:..|.|||||...:|..|||..|...:|.:   ::.:...:.:..||:.
Human   210 IEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWLPIG 274

  Fly   161 AIVDEKIFCCHGGLS--PDLTSMEQIRR------IMRPTDV------------------------ 193
            .|||.:|...|||:|  .||..:.::.|      ::.||:.                        
Human   275 TIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIK 339

  Fly   194 ----PDQGL-------LCDLLWSDPDKDTIGWGEND------RGVSFTFGAEVVVKFLQKHDLDL 241
                |.:.|       :.|:|||||.      |:|.      ||....||.:|..|.|.|:.|.:
Human   340 TNGSPTEHLTEHEWEQIIDILWSDPR------GKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKM 398

  Fly   242 ICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCS--------FQILK--- 295
            :.|:|:...:|||.....::||:|||.||..|..|.||.:.     :||        :|:.|   
Human   399 LIRSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIK-----LCSGTTPRFFQYQVTKATC 458

  Fly   296 --PVEKR 300
              |:.:|
Human   459 FQPLRQR 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 97/329 (29%)
MPP_PP1_PPKL 6..296 CDD:277359 96/326 (29%)
PPEF1NP_001364915.1 IQ 18..37 CDD:197470
MPP_RdgC 115..452 CDD:277364 94/317 (30%)
Catalytic 121..455 95/320 (30%)
EF-hand_7 568..636 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.