DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and PPEF2

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_006230.2 Gene:PPEF2 / 5470 HGNCID:9244 Length:753 Species:Homo sapiens


Alignment Length:397 Identity:100/397 - (25%)
Similarity:156/397 - (39%) Gaps:143/397 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QLSEGEIRGLCLKSREILLAQPILLELEA----PLKICGDIHGQYYDLLRLFEYGGYP-PEANYL 86
            ||....:..|..::::.|:..|.:..:..    .:.:|||:|||..||:.:|...|.| ||.:|:
Human   140 QLHARYVLNLLYETKKHLVQLPNINRVSTCYSEEITVCGDLHGQLDDLIFIFYKNGLPSPERSYV 204

  Fly    87 FLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYTI---KLWK 148
            |.||:|||||.|:|.:.:|.|:.:.|.:.|.|.|||||...:|..|||..|...:|.:   ::.:
Human   205 FNGDFVDRGKDSVEILMILFAFMLVYPKEFHLNRGNHEDHMVNLRYGFTKEVMNKYKVHGKEILR 269

  Fly   149 TFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMR------------------------ 189
            |..|.|..||:..::|||:...|||:| |:|.:|.:.:|.|                        
Human   270 TLQDVFCWLPLATLIDEKVLILHGGVS-DITDLELLDKIERSKIVSTMRCKTRQKSEKQMEEKRR 333

  Fly   190 -----------PTDVPDQ----------------------------------------------- 196
                       |..:|:.                                               
Human   334 ANQKSSAQGPIPWFLPESRSLPSSPLRLGSYKAQKTSRSSSIPCSGSLDGRELSRQVRSSVELEL 398

  Fly   197 -------GLL---------------------------------CDLLWSDP------DKDTIGWG 215
                   |||                                 .|:|||||      ..:||   
Human   399 ERCRQQAGLLVTGEKEEPSRSASEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKANTI--- 460

  Fly   216 ENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAM 280
               ||....||.:|..:.|||:::..:.|:|:...:||||...|:::|:|||.||.....|.||.
Human   461 ---RGGGCYFGPDVTQQLLQKYNMQFLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAY 522

  Fly   281 MSVDNTL 287
            :.:...|
Human   523 VKLGPAL 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 100/397 (25%)
MPP_PP1_PPKL 6..296 CDD:277359 100/397 (25%)
PPEF2NP_006230.2 MPP_RdgC 122..537 CDD:277364 100/397 (25%)
Catalytic 128..540 100/397 (25%)
PP2Ac 141..540 CDD:197547 99/396 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..382 2/63 (3%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 409..435 0/25 (0%)
EFh 657..722 CDD:238008
EF-hand_7 657..721 CDD:290234
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 732..753
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.