DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and Pp1-87B

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster


Alignment Length:302 Identity:283/302 - (93%)
Similarity:295/302 - (97%) Gaps:0/302 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEVLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHG 65
            |.:|:|::|||||||||||||||||||||||||||||||||||.|:|||||||||||||||||||
  Fly     1 MGDVMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHG 65

  Fly    66 QYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINR 130
            |||||||||||||:|||:|||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 QYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINR 130

  Fly   131 IYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPD 195
            ||||||||||||:||||||||||||||||.|||||||||||||||||||||||||||||||||||
  Fly   131 IYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPD 195

  Fly   196 QGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQ 260
            ||||||||||||||||:||||||||||||||||||.||||||:.||||||||||||||||||||.
  Fly   196 QGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRM 260

  Fly   261 LVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKRKK 302
            ||||||||||||||||||||||||:|||||||||||.:||||
  Fly   261 LVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 277/293 (95%)
MPP_PP1_PPKL 6..296 CDD:277359 275/289 (95%)
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 275/289 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449145
Domainoid 1 1.000 356 1.000 Domainoid score I201
eggNOG 1 0.900 - - E1_COG0639
Homologene 1 1.000 - - H100608
Inparanoid 1 1.050 514 1.000 Inparanoid score I297
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - mtm1134
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X337
1211.800

Return to query results.
Submit another query.