DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and CanA1

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster


Alignment Length:287 Identity:109/287 - (37%)
Similarity:166/287 - (57%) Gaps:24/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LSEGEIR-----GLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLF 87
            |.||.|.     .:..:...:|..:..::::|||:.:|||||||::||::|||.||.|....|||
  Fly    91 LLEGRIEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLF 155

  Fly    88 LGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTD 152
            ||||||||..|:|.:..|.:.||.|.....||||||||..:...:.|..||..:|:..::....:
  Fly   156 LGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACME 220

  Fly   153 CFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGEN 217
            .|:|||:.|:::::..|.||||||::.:::.|:.:.|..:.|..|.:||||||||.:|......|
  Fly   221 AFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTN 285

  Fly   218 D-------RGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPN 269
            :       ||.|:.|......:||||::|..|.|||:..:.||..:.|.|      |:|:|||||
  Fly   286 EFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPN 350

  Fly   270 YCGEFDNAGAMMSVDNTLM------CS 290
            |...::|..|::..:|.:|      ||
  Fly   351 YLDVYNNKAAVLKYENNVMNIRQFNCS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 109/287 (38%)
MPP_PP1_PPKL 6..296 CDD:277359 109/287 (38%)
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 109/287 (38%)
PP2Ac 98..369 CDD:197547 102/270 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.